PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kaladp0032s0353.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family GATA
Protein Properties Length: 288aa    MW: 32506.6 Da    PI: 7.5178
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kaladp0032s0353.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.67.3e-18201235135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          Cs+C + kTp+WR gp g+ktLCnaCG++y++ +l
  Kaladp0032s0353.1.p 201 CSHCASEKTPQWRTGPMGPKTLCNACGVRYKSGRL 235
                          *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004016.4E-18195245IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.438195231IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.19E-14199259No hitNo description
Gene3DG3DSA:3.30.50.104.3E-14199233IPR013088Zinc finger, NHR/GATA-type
PfamPF003208.8E-16201235IPR000679Zinc finger, GATA-type
PROSITE patternPS003440201226IPR000679Zinc finger, GATA-type
CDDcd002027.97E-14201247No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MDEFFRVDDL LNFSNDDHVF SSITTDHSDH HHHHHHHLHQ NQQLNSSSEH MVDYQLKNYY  60
DRSNNLPRCN NSSFSSVSGP AAAAAAAFGA QHFSYEFTDQ LCVPNDDVAE LEWLSNFVDD  120
SFNDFNSNAL TGTLMSQSHT SIPSAARSKR SRQRTWKAST SLISSSTAPQ IDRSRTKRQE  180
TNSMSEFVDD SSSSSGGVRR CSHCASEKTP QWRTGPMGPK TLCNACGVRY KSGRLVPEYR  240
PAASPTFVLT QHSNSHRKVM ELRRQKEVTI KQQQGHVYRH SHDFEVC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1148153KRSRQR
2172177RSRTKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002277959.11e-81PREDICTED: GATA transcription factor 4
SwissprotO497411e-68GATA2_ARATH; GATA transcription factor 2
TrEMBLF6GV651e-81F6GV65_VITVI; Putative uncharacterized protein
STRINGVIT_15s0021g02510.t014e-81(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45050.14e-64GATA transcription factor 2